PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_015902404.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rhamnaceae; Paliureae; Ziziphus
Family MYB_related
Protein Properties Length: 354aa    MW: 38204.9 Da    PI: 7.9673
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_015902404.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding39.51.3e-12107151347
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      +WT+eE+  ++ + ++lG+g+W+ Iar     Rt+ q+ s+ qky
   XP_015902404.1 107 PWTEEEHRMFLIGLQKLGKGDWRGIARNYVVSRTPTQVASHAQKY 151
                      8*******************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129420.331100156IPR017930Myb domain
SuperFamilySSF466897.48E-17102157IPR009057Homeodomain-like
TIGRFAMsTIGR015572.9E-19103155IPR006447Myb domain, plants
SMARTSM007171.1E-9104154IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.3E-11104150IPR009057Homeodomain-like
CDDcd001677.49E-9107152No hitNo description
PfamPF002493.4E-10107151IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009651Biological Processresponse to salt stress
GO:0009723Biological Processresponse to ethylene
GO:0009733Biological Processresponse to auxin
GO:0009739Biological Processresponse to gibberellin
GO:0009753Biological Processresponse to jasmonic acid
GO:0046686Biological Processresponse to cadmium ion
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 354 aa     Download sequence    Send to blast
MTRRCSHCSN NGHNSRTCPS RGGVGGGSGS GVKLFGVRLT DGSIIKKSAS MGNLSAHYHS  60
SSSAADSPNP DSPSSDPLHE PDGYLSDDPT HASCSTNRRG ERKKGVPWTE EEHRMFLIGL  120
QKLGKGDWRG IARNYVVSRT PTQVASHAQK YFIRQTNATR RKRRSSLFDM VPDMVTDTPP  180
VPEEVLLPSP QGRESDNAQS LPSLNLSLQS ECEPMEAAHN LKAKEPEEPA MGLNGYPPMV  240
PGFYPAYLPV PFPLWPPSAS PLEEKGAETS HHQVLKPIPM LPKEPVNVDE LVGMSQLSLG  300
EAERDLREPS PLSLKLLGEP SRQSAFHANA PVGGNAPVSG SDLRKGKSSA IQAI
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015902398.10.0PREDICTED: uncharacterized protein LOC107435329
RefseqXP_015902404.10.0PREDICTED: uncharacterized protein LOC107435334
TrEMBLW9R6M00.0W9R6M0_9R
STRINGGLYMA13G43120.11e-166(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF77193346
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G16350.11e-92MYB_related family protein